Protein coding transcript 84758

• Transcript: Ll_transcript_497841
• CDS coordinates: 937-1449 (+)
• Peptide sequence: MSKFCLWYQIDENVQREIINHRSLKHPNIIRFKEVFLTPSHLAIVLEYASGGELFERICTAGRFSEDEARYFFQQLISGVSYCHTMEICHRDLKLENTLLDGNPSPRLKICDFGYSKSAILHSQPKSTVGTPAYIAPEVLSRKEYDGKVYIICGIFMIVLKLILATFSGN*
• ORF Type: complete

Annotations of Ll_transcript_497841

• Blastp: Serine/threonine-protein kinase SAPK3 from Oryza sativa with 84.42% of identity
• Blastx: Serine/threonine-protein kinase SAPK3 from Oryza sativa with 84.42% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (4349411)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446038.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;