Transcript | Ll_transcript_498214 |
---|---|
CDS coordinates | 49-777 (+) |
Peptide sequence | MEKLVLHSPSIPTPTPQQQFLFHNSLFPSFKSRTPFHQTSSYLSCITTTRRNPHFQALANGDAEIVDDELSFLSLTGKPDRNLALLDDYESDELDFDSDPNHRSGYVALLGKPNVGKSTLANQMVGQKLSIVTDKPQTTRHRILCICSSPDYQMVLYDTPGVLKKEMHKLDSMMMKNVRTAAVNADCVLVVVDACKAPEKIDELLEEGIGDLKEKPPTLLILNKKDLIKPGEVAKKLEVVTN* |
ORF Type | complete |
Blastp | GTPase ERA-like, chloroplastic from Arabidopsis with 69.52% of identity |
---|---|
Blastx | GTPase ERA-like, chloroplastic from Arabidopsis with 63.64% of identity |
Eggnog | An essential GTPase that binds both GDP and GTP, with rapid nucleotide exchange. Plays a role in 16S rRNA processing and 30S ribosomal subunit biogenesis and possibly also in cell cycle regulation and energy metabolism (By similarity)(COG1159) |
Kegg | Link to kegg annotations (AT5G66470) |
CantataDB | Link to cantataDB annotations (CNT0000167) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019432261.1) |
Pfam | 50S ribosome-binding GTPase (PF01926.22) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer