Protein coding transcript 84770

• Transcript: Ll_transcript_498216
• CDS coordinates: 17-451 (+)
• Peptide sequence: MKHTGVKKRPGCSWVQGREGFATFYVGDRSHSQSQQIYEILADLIQSIKAIGYVPQTSFALHDVDDEEKGDLLSEHSEKLALAYGILTSLPGTPIRITKNLRICGDCHSAITYISMIIDHEIILRDSSRFHHFKNGSCSCKGYW*
• ORF Type: complete

Annotations of Ll_transcript_498216

• Blastp: Pentatricopeptide repeat-containing protein At5g16860 from Arabidopsis with 74.31% of identity
• Blastx: Pentatricopeptide repeat-containing protein At5g16860 from Arabidopsis with 74.48% of identity
• Eggnog: Pentatricopeptide repeat-containing protein(ENOG410Z7Z7)
• Kegg: Link to kegg annotations (AT5G16860)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420641.1)
• Pfam: DYW family of nucleic acid deaminases (PF14432.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;