Protein coding transcript 84773

• Transcript: Ll_transcript_498222
• CDS coordinates: 49-513 (+)
• Peptide sequence: MEKLVLHSPSIPTPTPQQQFLFHNSLFPSFKSRTPFHQTSSYLSCITTTRRNPHFQALANGDAEIVDDELSFLSLTGKPDRNLALLDDYESDELDFDSDPNHRSGYVALLGKPNVGKSTLANQMVGQKLSIVTDKPQTTRHRILCICSSPDYQV*
• ORF Type: complete

Annotations of Ll_transcript_498222

• Blastp: GTPase ERA-like, chloroplastic from Arabidopsis with 66.99% of identity
• Blastx: GTPase ERA-like, chloroplastic from Arabidopsis with 66.99% of identity
• Eggnog: An essential GTPase that binds both GDP and GTP, with rapid nucleotide exchange. Plays a role in 16S rRNA processing and 30S ribosomal subunit biogenesis and possibly also in cell cycle regulation and energy metabolism (By similarity)(COG1159)
• Kegg: Link to kegg annotations (AT5G66470)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432261.1)
• Pfam: 50S ribosome-binding GTPase (PF01926.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;