Protein coding transcript 84809

• Transcript: Ll_transcript_497779
• CDS coordinates: 1816-2256 (+)
• Peptide sequence: MPKISDFGLAKLIPSHLTHVSTRVAGTIGYLAPEYAIRGQLTRKADIYSFGVLLVEIVSGRCNTNARLPTGDEYILAKVCLSYVPSCIDIPTKLKVLTDHILQHYMRLLDQRLYNILSLQTWELYEQGELIRLVDISLNGFFDAEEA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_497779

• Blastp: Cold-responsive protein kinase 1 from Arabidopsis with 54.79% of identity
• Blastx: Cold-responsive protein kinase 1 from Arabidopsis with 61.08% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT1G16670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432372.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;