Protein coding transcript 84843

• Transcript: Ll_transcript_498246
• CDS coordinates: 96-629 (+)
• Peptide sequence: MATPPDPLATSTTATAADAGETLSKNALKRELKNKQREEERKRKEEEKAKKAAEVQQAKDNNKSATAADEEDMDPTQYHENRLKSLAAQKAEGNNPYPHKFFVSLSIEEYIKKYGGLNNGEHLEDVSVSLSGRIMHKRASGAKLVFYDLHGGGFKVQVMADARYLIFNFLKRGHMWR*
• ORF Type: complete

Annotations of Ll_transcript_498246

• Blastp: Lysine--tRNA ligase, cytoplasmic from Arabidopsis with 62.42% of identity
• Blastx: Lysine--tRNA ligase, cytoplasmic from Arabidopsis with 66.67% of identity
• Eggnog: lysyl-trna synthetase(COG1190)
• Kegg: Link to kegg annotations (AT3G11710)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439359.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;