Transcript | Ll_transcript_498246 |
---|---|
CDS coordinates | 96-629 (+) |
Peptide sequence | MATPPDPLATSTTATAADAGETLSKNALKRELKNKQREEERKRKEEEKAKKAAEVQQAKDNNKSATAADEEDMDPTQYHENRLKSLAAQKAEGNNPYPHKFFVSLSIEEYIKKYGGLNNGEHLEDVSVSLSGRIMHKRASGAKLVFYDLHGGGFKVQVMADARYLIFNFLKRGHMWR* |
ORF Type | complete |
Blastp | Lysine--tRNA ligase, cytoplasmic from Arabidopsis with 62.42% of identity |
---|---|
Blastx | Lysine--tRNA ligase, cytoplasmic from Arabidopsis with 66.67% of identity |
Eggnog | lysyl-trna synthetase(COG1190) |
Kegg | Link to kegg annotations (AT3G11710) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019439359.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer