Protein coding transcript 84858

• Transcript: Ll_transcript_496785
• CDS coordinates: 47-598 (+)
• Peptide sequence: MDSIVATPLHTNPPQELKYKTGIMAFDKDILQNLQEIPKQFQWPESDLVATSDELLNEPLIDLEVMTKGDEAAMATAAELVRNACIKHGFFQVTNHGVDQDLINAAYTEMQTIFNLPLSTKLSANRKPGTLEGYSSAHGDRFTAKLPWKETYTFRRNHTQESESSEVVDFIKKSFGEELHHTA*
• ORF Type: complete

Annotations of Ll_transcript_496785

• Blastp: Gibberellin 20 oxidase 1-D from Triticum with 43.51% of identity
• Blastx: Gibberellin 20 oxidase 1-D from Triticum with 43.51% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458771.1)
• Pfam: non-haem dioxygenase in morphine synthesis N-terminal (PF14226.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;