Transcript | Ll_transcript_498105 |
---|---|
CDS coordinates | 126-1070 (+) |
Peptide sequence | MEGLTTRGGGEGLRHLFMTMFLTSFGGVIVIPAMTDVTLAALCPDQDQCSLAIYLTGFQQAMTGMGSVVMTPLIGNLSDRYGRKALLTLPLLLSVIPHVILAYSRDTNFFYAYYVVKTLAAMAGEGSFNCLALAYVADNVPEGKRGSTFGVLSGVGSASFVGGTLAARFLSTALTFQVAAVFSMIALVYMRIFLKESVPGAGGGAMTKPLLKEGQEPCLQQCEGDSSNITTGTFKKLPSVGDLISMLKCSTTFSQAAVVLFLNSLVDGGLMASLLYYLKARFQFNKNQFADLMMITGIGATLTQACGTPKSLLA* |
ORF Type | complete |
Blastp | Hippocampus abundant transcript 1 protein from Homo with 25.16% of identity |
---|---|
Blastx | Hippocampus abundant transcript 1 protein from Mus with 25% of identity |
Eggnog | solute carrier family 46(ENOG410ZVCA) |
Kegg | Link to kegg annotations (64645) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019441713.1) |
Pfam | Major Facilitator Superfamily (PF07690.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer