Protein coding transcript 84947

• Transcript: Ll_transcript_496991
• CDS coordinates: 1700-2569 (+)
• Peptide sequence: MGEFQIQPDLISYSTIMNAWSQAGYLEKCKEVFNDMLKFGVEPDAHVYGILAKGYVRAQETEKAEELLTAMVKPGVRPTVVTFTTVISGWCSAGRMEDAMRVFDKMCESGVSPNLNTFETLIWGYAEARQPSKAEGILQIMEDFRVAAKKSTMLLVAEAWCLAGLVEEANRVLRAVKTKQMSNSIEEDENIESEGLKNMKQKSYTNTPLGTLLHIPSICINEGSLLASRRNRRLLRDSILEIPLNSTKLKCHSQICRFGEGFSIMCQKQFQCQHGTYQLANSCTAVFLN*
• ORF Type: complete

Annotations of Ll_transcript_496991

• Blastp: Pentatricopeptide repeat-containing protein At5g25630 from Arabidopsis with 47.59% of identity
• Blastx: Maturase K from Lupinus with 97.72% of identity
• Eggnog: Pentatricopeptide repeat-containing protein(ENOG410Z7Z7)
• Kegg: Link to kegg annotations (AT5G25630)
• CantataDB: Link to cantataDB annotations (CNT0000960)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457869.1)
• Pfam: Pentatricopeptide repeat domain (PF13812.5)
• Rfam: Intron_gpII (RF00029)
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;