Transcript | Ll_transcript_496991 |
---|---|
CDS coordinates | 1700-2569 (+) |
Peptide sequence | MGEFQIQPDLISYSTIMNAWSQAGYLEKCKEVFNDMLKFGVEPDAHVYGILAKGYVRAQETEKAEELLTAMVKPGVRPTVVTFTTVISGWCSAGRMEDAMRVFDKMCESGVSPNLNTFETLIWGYAEARQPSKAEGILQIMEDFRVAAKKSTMLLVAEAWCLAGLVEEANRVLRAVKTKQMSNSIEEDENIESEGLKNMKQKSYTNTPLGTLLHIPSICINEGSLLASRRNRRLLRDSILEIPLNSTKLKCHSQICRFGEGFSIMCQKQFQCQHGTYQLANSCTAVFLN* |
ORF Type | complete |
Blastp | Pentatricopeptide repeat-containing protein At5g25630 from Arabidopsis with 47.59% of identity |
---|---|
Blastx | Maturase K from Lupinus with 97.72% of identity |
Eggnog | Pentatricopeptide repeat-containing protein(ENOG410Z7Z7) |
Kegg | Link to kegg annotations (AT5G25630) |
CantataDB | Link to cantataDB annotations (CNT0000960) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019457869.1) |
Pfam | Pentatricopeptide repeat domain (PF13812.5) |
Rfam | Intron_gpII (RF00029) |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer