Protein coding transcript 85004

• Transcript: Ll_transcript_497330
• CDS coordinates: 470-1039 (+)
• Peptide sequence: MLLLMIFFLLKITVSRFCTRSLLHESLDYALIDKVPGVPNDRKTLLGELNWIFTAVTDSIAWNVLPHELFQRLFRQDLLVASLFRNFLLAERIMRSANCSPVSHPTLPPTHQHHMWDAWDMAAELCLSQLPSLVEDPNAEFQPSTFFTEQLTAFEVWLDHGAEHKKQPEQLPIVLQVLLSQCHRFRALVL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_497330

• Blastp: Regulatory-associated protein of TOR 1 from Arabidopsis with 84.53% of identity
• Blastx: Regulatory-associated protein of TOR 1 from Arabidopsis with 85% of identity
• Eggnog: regulatory associated protein of MTOR(ENOG410XQKJ)
• Kegg: Link to kegg annotations (AT3G08850)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020203763.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;