Protein coding transcript 85074

• Transcript: Ll_transcript_498461
• CDS coordinates: 224-844 (+)
• Peptide sequence: MAEKSCIKRLQKEYRALCKDPVSHVVARPSPNDILEWHYVLEGSEGTPFAGGYYYGKIKFPPEYPYKPPGISMTTPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDNSPTTGSVNTTTAEKQRLAKSSLSFNCKNATFRKMFPEYVEKYNQQQLSEQVASEKVLSEASRDKSSSPVVEKNLNSTREDMKKVDGLKE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_498461

• Blastp: Ubiquitin-conjugating enzyme E2 34 from Arabidopsis with 79.23% of identity
• Blastx: Ubiquitin-conjugating enzyme E2 34 from Arabidopsis with 79.23% of identity
• Eggnog: Ubiquitin-conjugating enzyme E2(ENOG410Z0AN)
• Kegg: Link to kegg annotations (AT1G17280)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430306.1)
• Pfam: Ubiquitin-conjugating enzyme (PF00179.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;