Protein coding transcript 85075

• Transcript: Ll_transcript_498464
• CDS coordinates: 1658-2029 (+)
• Peptide sequence: MDNSPTTGSVNTTTAEKQRLAKSSLSFNCKNATFRKMFPEYVEKYNQQQLSEQVASEKVLSEASRDKSSSPVVEKNLNSTREDMKKVDGLKEVRKKKQPFPTWMMLLLFSIFGVVMALPLLQL*
• ORF Type: complete

Annotations of Ll_transcript_498464

• Blastp: Ubiquitin-conjugating enzyme E2 34 from Arabidopsis with 59.68% of identity
• Blastx: Ubiquitin-conjugating enzyme E2 34 from Arabidopsis with 59.68% of identity
• Eggnog: Ubiquitin-conjugating enzyme E2(ENOG410Z0AN)
• Kegg: Link to kegg annotations (AT1G17280)
• CantataDB: Link to cantataDB annotations (CNT0000963)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430306.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;