Transcript | Ll_transcript_498471 |
---|---|
CDS coordinates | 1150-1518 (+) |
Peptide sequence | MDNSPTTGSVNTTTVEKQHLAKSSLAFNCKNATFRKMFPEYVEMYNQQQLSEQVAFDKVASEESNDKSSSPVSENNSTRVDIKKVDGLKDVRKNKKQPFPTWMMLLLFSIFGVVMALPLLQL* |
ORF Type | complete |
Blastp | Ubiquitin-conjugating enzyme E2 34 from Arabidopsis with 61.6% of identity |
---|---|
Blastx | Ubiquitin-conjugating enzyme E2 34 from Arabidopsis with 58.39% of identity |
Eggnog | Ubiquitin-conjugating enzyme E2(ENOG410Z0AN) |
Kegg | Link to kegg annotations (AT1G17280) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019461043.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer