Protein coding transcript 85077

• Transcript: Ll_transcript_498471
• CDS coordinates: 1150-1518 (+)
• Peptide sequence: MDNSPTTGSVNTTTVEKQHLAKSSLAFNCKNATFRKMFPEYVEMYNQQQLSEQVAFDKVASEESNDKSSSPVSENNSTRVDIKKVDGLKDVRKNKKQPFPTWMMLLLFSIFGVVMALPLLQL*
• ORF Type: complete

Annotations of Ll_transcript_498471

• Blastp: Ubiquitin-conjugating enzyme E2 34 from Arabidopsis with 61.6% of identity
• Blastx: Ubiquitin-conjugating enzyme E2 34 from Arabidopsis with 58.39% of identity
• Eggnog: Ubiquitin-conjugating enzyme E2(ENOG410Z0AN)
• Kegg: Link to kegg annotations (AT1G17280)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461043.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;