Protein coding transcript 85079

• Transcript: Ll_transcript_498476
• CDS coordinates: 500-1207 (+)
• Peptide sequence: MAEKACIKRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSEGTPFAGGYYYGKIKFPPEYPYKPPGISMTTPNGRFMTQKKICLSMSDFHPESWNPMWSASSILTGLLSFMMDNSPTTGSVNTTTVEKQHLAKSSLAFNCKNATFRKMFPEYVEKYKEQQLASERISLEMSIDESTRPAPEKVLDLMDDVNRVNELKDVRRNKRQPSPTWMVFLLVCIFGVVMALPLLQLL*
• ORF Type: complete

Annotations of Ll_transcript_498476

• Blastp: Probable ubiquitin-conjugating enzyme E2 33 from Arabidopsis with 74.49% of identity
• Blastx: Probable ubiquitin-conjugating enzyme E2 33 from Arabidopsis with 73.84% of identity
• Eggnog: Ubiquitin-conjugating enzyme E2(ENOG410Z0AN)
• Kegg: Link to kegg annotations (AT5G50430)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423599.1)
• Pfam: Ubiquitin-conjugating enzyme (PF00179.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;