Protein coding transcript 85124

• Transcript: Ll_transcript_498035
• CDS coordinates: 161-1096 (+)
• Peptide sequence: MKEMAYCFKYHHHFLHHFHSVLKTLPSPRRRFRRIHFSNLHTPNLNLRSSHAGYCSSASSILTSDSREIVAAPNTDPANGRVMLIDGTSVIHRSYYKLLAKLHHGHLANADGNGDWVLTIFTALSLIIDVLELIPSHVVVVFDHDGVPFGPTYNSSKGSFTAKGQNFRHNLYPSYKSNRPPTPDTIVQGLQYLKASIKAMSIKVIEVPGVEADDVIGTLAIRSVDAGYKVRVVSPDKDFFQILSPSLRLLRIAPRGDQMVSFGVEDFEKRFGGLKPSQFVDMIALTGDRADNIPGYFVLLYVDTETSFAEI*
• ORF Type: complete

Annotations of Ll_transcript_498035

• Blastp: DNA polymerase I, thermostable from Thermus with 33.49% of identity
• Blastx: DNA polymerase I, thermostable from Thermus with 33.49% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424416.1)
• Pfam: 5'-3' exonuclease, N-terminal resolvase-like domain (PF02739.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;