Protein coding transcript 85129

• Transcript: Ll_transcript_498042
• CDS coordinates: 687-1025 (+)
• Peptide sequence: MSIKVIEVPGVEADDVIGTLAIRSVDAGYKVRVVSPDKDFFQILSPSLRLLRIAPRGDQMVSFGVEDFEKRFGGLKPSQFVDMIALTGDRADNIPGYFVLLYVDTETSFAEI*
• ORF Type: complete

Annotations of Ll_transcript_498042

• Blastp: 5'-3' exonuclease from Aquifex with 43.62% of identity
• Blastx: DNA polymerase I, thermostable from Thermus with 41.91% of identity
• Eggnog: Structure-specific nuclease with 5'-flap endonuclease and 5'-3' exonuclease activities involved in DNA replication and repair. During DNA replication, cleaves the 5'-overhanging flap structure that is generated by displacement synthesis when DNA polymerase encounters the 5'-end of a downstream Okazaki fragment. It enters the flap from the 5'-end and then tracks to cleave the flap base, leaving a nick for ligation. Also involved in the long patch base excision repair (LP-BER) pathway, by cleaving within the apurinic apyrimidinic (AP) site-terminated flap. Acts as a genome stabilization factor that prevents flaps from equilibrating into structurs that lead to duplications and deletions. Also possesses 5'-3' exonuclease activity on nicked or gapped double- stranded DNA, and exhibits RNase H activity. Also involved in replication and repair of rDNA and in repairing mitochondrial DNA (By similarity)(COG0258)
• Kegg: Link to kegg annotations (aq_1628)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424416.1)
• Pfam: 5'-3' exonuclease, N-terminal resolvase-like domain (PF02739.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;