Protein coding transcript 85130

• Transcript: Ll_transcript_498043
• CDS coordinates: 2187-2528 (+)
• Peptide sequence: MVSFGVEDFEKRFGGLKPSQFVDMIALTGDRADNIPGVHGIGDVHAVQLISKFGTLERLLDSVDQVAEDRIKKVCMVNVMLCVQLLFDVMVTLFSLDLDIAWFNMICKVSPCN*
• ORF Type: complete

Annotations of Ll_transcript_498043

• Blastp: DNA polymerase I from Geobacillus with 49.15% of identity
• Blastx: DNA polymerase I, thermostable from Thermus with 38.64% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424417.1)
• Pfam: 5'-3' exonuclease, C-terminal SAM fold (PF01367.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;