Transcript | Ll_transcript_497600 |
---|---|
CDS coordinates | 152-886 (+) |
Peptide sequence | MASSFTPTNTILGAPSSFITRSLSSPQSIPFQKHNCSLVVRCSATAAPSASSVVKASGEYSVKSVKARQIIDSRGNPTVEVDLVTDQVYRSAVPSGASTGIYEALELRDGDKNVYGGKGVLNAVRNINEFLAPKLVGIDVRNQADVDAIMLEIDGTPNKSKLGANAILGVSLSVCRAGAGAKGVPLYKHIQEISGTKELVMPVPAFNVINGGSHAGNNLAMQEFMILPVGATSFAEALRMGSEG* |
ORF Type | complete |
Blastp | Enolase 1, chloroplastic from Arabidopsis with 77.73% of identity |
---|---|
Blastx | Enolase 1, chloroplastic from Arabidopsis with 88.6% of identity |
Eggnog | Catalyzes the reversible conversion of 2- phosphoglycerate into phosphoenolpyruvate. It is essential for the degradation of carbohydrates via glycolysis (By similarity)(COG0148) |
Kegg | Link to kegg annotations (AT1G74030) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_006582042.1) |
Pfam | Enolase, N-terminal domain (PF03952.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer