Protein coding transcript 852

• Transcript: Ll_transcript_425023
• CDS coordinates: 383-805 (+)
• Peptide sequence: MAYRLNDYRVLFAPFTGLNHHGQPVLFGCALVLNESETPFLTFLEAMSGKHPISITTDHDRIIRSAVLEVLPKTRHRFCKWNVIKEAEERLSDVYHVNYNFEAEFLKCINATETTDEFESSWKSILQRYELMDNEWLHTM*
• ORF Type: complete

Annotations of Ll_transcript_425023

• Blastp: Protein FAR1-RELATED SEQUENCE 5 from Arabidopsis with 53.52% of identity
• Blastx: Protein FAR1-RELATED SEQUENCE 5 from Arabidopsis with 52.61% of identity
• Eggnog: protein FAR1-RELATED SEQUENCE 5-like(ENOG410ZJSX)
• Kegg: Link to kegg annotations (AT4G38180)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016179845.1)
• Pfam: MULE transposase domain (PF10551.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;