Transcript | Ll_transcript_496733 |
---|---|
CDS coordinates | 2-574 (+) |
Peptide sequence | DYIEPNFTSTKIMTSSSVGIKHLIFVSCIIFWACGNQATCRTLHASSLLSVIEKHENWMSQYGRYYIDDIEKSKRLMIFKENLEFIDNFNNNGENKTYELGLNQFADLTQEEFVALHTGLDYSNQKSFSSNMTTTLAAKENIPGTVNWKQHGAVTSVKAQGNCGSCWIFATVAAIEGIVKIKTGKLVIII* |
ORF Type | 5prime_partial |
Blastp | Senescence-specific cysteine protease SAG39 from Oryza sativa with 42.05% of identity |
---|---|
Blastx | Senescence-specific cysteine protease SAG39 from Oryza sativa with 42.05% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (107276017) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019415707.1) |
Pfam | Cathepsin propeptide inhibitor domain (I29) (PF08246.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer