Protein coding transcript 85250

• Transcript: Ll_transcript_496734
• CDS coordinates: 36-575 (+)
• Peptide sequence: MASISIGIKQTIFVSCIIFWACGNHRATCQTLNDQSLSSVIEIHENWMSQYGRYYLNDIEKSKRLMIFKENLEFIDNFNNNGENKTYELGLNQFADLTQEEFVALHTGLDYSNQKSFSSNMTTTLAAKENIPGTVNWKQHGAVTSVKAQGNCGSCWIFATVAAIEGIVKIKTGKLVIII*
• ORF Type: complete

Annotations of Ll_transcript_496734

• Blastp: Senescence-specific cysteine protease SAG39 from Oryza sativa with 47.86% of identity
• Blastx: Fruit bromelain from Ananas with 38.75% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (107276017)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415707.1)
• Pfam: Cathepsin propeptide inhibitor domain (I29) (PF08246.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;