Protein coding transcript 85252

• Transcript: Ll_transcript_496737
• CDS coordinates: 2-865 (+)
• Peptide sequence: DYIEPNFTSTKIMTSSSVGIKHLIFVSCIIFWACGNQATCRTLHASSLLSVIEKHENWMSQYGRYYIDDIEKSKRLMIFKENMKFIDNFNNNGENKTYELGLNKFADLTTEEFIALHTGLDNSIRKSFSSNMTSILAEKNIPKTIDWRRRGAVTNVKAQGGCGSCWIFATVAAIEGIVKIKTGNLISLSEQEVLDCSTQGCDGGNAQLVYQDIIQRHGITGENDYPYKESKGTCHQATPLAQISGFTNVLPNNEKLLQLAVAKQPVSAAITADPNFRFYKKGIFKGPC
• ORF Type: internal

Annotations of Ll_transcript_496737

• Blastp: Ananain from Ananas with 43.57% of identity
• Blastx: Ananain from Ananas with 43.75% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415707.1)
• Pfam: Cathepsin propeptide inhibitor domain (I29) (PF08246.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;