Transcript | Ll_transcript_496740 |
---|---|
CDS coordinates | 2-481 (+) |
Peptide sequence | DYIEPNFTSTKIMTSSSVGIKHLIFVSCIIFWACGNQIACQTLHDSSLLSVIEMHENWMSQYGRYYVDDIEKSERLKIFTENVKFIDNFNNNYENKTYELGLNQFGDLTTEEFITLHTGLDNSIRTSFSSNMATTSVKKNIPQSIDWRDHGAVTDVKFHG |
ORF Type | internal |
Blastp | Ananain from Ananas with 38.85% of identity |
---|---|
Blastx | Ananain from Ananas with 38.85% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019415706.1) |
Pfam | Cathepsin propeptide inhibitor domain (I29) (PF08246.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer