Protein coding transcript 85301

• Transcript: Ll_transcript_497149
• CDS coordinates: 268-897 (+)
• Peptide sequence: MPFYDADFINSQLSKRTSIFGLRLWVVIGILVGSFIVLFLFLLSLCLTSRRHRHRNTTKPKSQPKPQTKPQPKPKPKPQTIPVISKEIQEIVHVAPRLEIHVVDTTRKASGESACETTSSFGSGSVGPEVSHVGWGRWYTLRELEAATNGLCDENVIGEGGYGIVYRGLLPDGTKVAVKNLLNNKYLYMLLQFLYFSSLLINSYHFIII*
• ORF Type: complete

Annotations of Ll_transcript_497149

• Blastp: Probable serine/threonine-protein kinase At1g01540 from Arabidopsis with 59.9% of identity
• Blastx: Probable serine/threonine-protein kinase At1g01540 from Arabidopsis with 57.14% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT1G01540)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420761.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;