Protein coding transcript 85373

• Transcript: Ll_transcript_498644
• CDS coordinates: 217-702 (+)
• Peptide sequence: MEYNNMNVDVGLVVEAVSTDVGDAPLYTVESLCMRCGQNGITRFLFTSIPNFRKILLSAFECIHCSERNNEVQFAGEIQPRGCNYSLKVPSGDPKMLNRQVVKSESATIKIPELDLEIPPEAQRGSLSTVEGILMRAADELQALQEERKVEFVTVLYYCLV*
• ORF Type: complete

Annotations of Ll_transcript_498644

• Blastp: Zinc finger protein ZPR1 from Saccharomyces with 48.65% of identity
• Blastx: Zinc finger protein ZPR1 from Saccharomyces with 39.56% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (YGR211W)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420287.1)
• Pfam: ZPR1 zinc-finger domain (PF03367.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;