Protein coding transcript 85379

• Transcript: Ll_transcript_498651
• CDS coordinates: 158-514 (+)
• Peptide sequence: MTFPSTCGACVTQCETRMFVTNIPYFQEVIVMASTCDSCGYRNSELKPGGRIPEKGKTITLHVENVKDLSRDVIKSDTASVKVPEIDLELTSGTLGGVVTTVEGLITKICESLEKVHGF
• ORF Type: 3prime_partial

Annotations of Ll_transcript_498651

• Blastp: Zinc finger protein ZPR1 homolog from Dictyostelium with 56.78% of identity
• Blastx: Zinc finger protein ZPR1 homolog from Dictyostelium with 57.26% of identity
• Eggnog: zinc ion binding(COG1779)
• Kegg: Link to kegg annotations (DDB_G0269438)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424241.1)
• Pfam: ZPR1 zinc-finger domain (PF03367.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;