Protein coding transcript 85391

• Transcript: Ll_transcript_498664
• CDS coordinates: 139-615 (+)
• Peptide sequence: MEQIVDVGSVAEAVSTDVGDAPLYAVESLCMRCGENGITRFLFTSIPNFRKILLSAFECTHCNERNNEVQFAGEIQSRGCSFSLQIPSGDPKMLNRQVVKSESATIKIPELDLEIPPEAQRGSLSTVEGILMRAADELQALQEERKVEFVTVLYYCLV*
• ORF Type: complete

Annotations of Ll_transcript_498664

• Blastp: Zinc finger protein ZPR1 from Papio with 48.36% of identity
• Blastx: Zinc finger protein ZPR1 from Saccharomyces with 38.31% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420287.1)
• Pfam: ZPR1 zinc-finger domain (PF03367.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;