Transcript | Ll_transcript_498641 |
---|---|
CDS coordinates | 217-702 (+) |
Peptide sequence | MEYNNMNVDVGLVVEAVSTDVGDAPLYTVESLCMRCGQNGITRFLFTSIPNFRKILLSAFECIHCSERNNEVQFAGEIQPRGCNYSLKVPSGDPKMLNRQVVKSESATIKIPELDLEIPPEAQRGSLSTVEGILMRAADELQALQEERKVEFVTVLYYCLV* |
ORF Type | complete |
Blastp | Zinc finger protein ZPR1 from Saccharomyces with 48.65% of identity |
---|---|
Blastx | Zinc finger protein ZPR1 from Saccharomyces with 50.76% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (YGR211W) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019420287.1) |
Pfam | ZPR1 zinc-finger domain (PF03367.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer