| Transcript | Ll_transcript_498937 |
|---|---|
| CDS coordinates | 1154-1459 (+) |
| Peptide sequence | MFKSPFSSICLPTLSLRFSGKKCDAAAKGRKRRNESTSKGKSEANPNKLITIQIPPTLKKQLVDDCEFITHMGKLVKLPRTPNVDDILKKYLDQRLKKHGS* |
| ORF Type | complete |
| Blastp | Protein MRG2 from Arabidopsis with 54.67% of identity |
|---|---|
| Blastx | Protein MRG2 from Arabidopsis with 54.67% of identity |
| Eggnog | Mortality factor 4-like protein(ENOG410XR9F) |
| Kegg | Link to kegg annotations (AT1G02740) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019437920.1) |
| Pfam | MRG (PF05712.12) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer