| Transcript | Ll_transcript_498014 |
|---|---|
| CDS coordinates | 1405-1722 (+) |
| Peptide sequence | MTVKIVLNPRVHLVPYHIDEGQPSYLIIAGLVFTPLSEPLIEEECEDTIGLKLLAKARYSLARFEGEQIVILSQVLANEVNIGYEDMSNLQVLKLNGSPIKNIQHL |
| ORF Type | 3prime_partial |
| Blastp | Protease Do-like 2, chloroplastic from Arabidopsis with 85.58% of identity |
|---|---|
| Blastx | Protease Do-like 2, chloroplastic from Arabidopsis with 84.29% of identity |
| Eggnog | Serine protease(COG0265) |
| Kegg | Link to kegg annotations (AT2G47940) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019428852.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer