Protein coding transcript 85474

• Transcript: Ll_transcript_498021
• CDS coordinates: 360-1055 (+)
• Peptide sequence: MIGGRKLLTNAHCVEHETQVKVKRRGDDTKYVAKVLARGVDCDIALLSVESDEFWREVKPLRFGRLPHLQDSVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSDLLGIQIDAAINPGNSGGPAFNAQGECIGVAFQVLRSEDAENIGYVIPTTVVSHFLSDYEKNGRYTGFACLGVLIQKLENPVLRTYLKVKSNEGVLVRRVEPTSDANNVLKEGDVIVRFDDVRVGCE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_498021

• Blastp: Protease Do-like 2, chloroplastic from Arabidopsis with 85.34% of identity
• Blastx: Protease Do-like 2, chloroplastic from Arabidopsis with 78.03% of identity
• Eggnog: Serine protease(COG0265)
• Kegg: Link to kegg annotations (AT2G47940)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428855.1)
• Pfam: Trypsin-like peptidase domain (PF13365.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;