Protein coding transcript 85476

• Transcript: Ll_transcript_498023
• CDS coordinates: 3-578 (+)
• Peptide sequence: KVKVVLNPRVHLVPYHIDGGQPSYLIIAGLVFTPLSEPLIEEECEDTIGLKLLAKARYSLAKFEGEQIVILSQVLANEVNIGYEDMNNLQVLKFNGTRIKNIQHLAHLVDSCKDRYLCFEFEDSYVAVLERKAAATASSCILTDYGIPSERSPDLLKPYVNSLEGDPSAEKEFGDIPVSNYEIGVDGLFWA*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_498023

• Blastp: Protease Do-like 2, chloroplastic from Arabidopsis with 77.49% of identity
• Blastx: Protease Do-like 2, chloroplastic from Arabidopsis with 77.49% of identity
• Eggnog: Serine protease(COG0265)
• Kegg: Link to kegg annotations (AT2G47940)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441797.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;