Transcript | Ll_transcript_498023 |
---|---|
CDS coordinates | 3-578 (+) |
Peptide sequence | KVKVVLNPRVHLVPYHIDGGQPSYLIIAGLVFTPLSEPLIEEECEDTIGLKLLAKARYSLAKFEGEQIVILSQVLANEVNIGYEDMNNLQVLKFNGTRIKNIQHLAHLVDSCKDRYLCFEFEDSYVAVLERKAAATASSCILTDYGIPSERSPDLLKPYVNSLEGDPSAEKEFGDIPVSNYEIGVDGLFWA* |
ORF Type | 5prime_partial |
Blastp | Protease Do-like 2, chloroplastic from Arabidopsis with 77.49% of identity |
---|---|
Blastx | Protease Do-like 2, chloroplastic from Arabidopsis with 77.49% of identity |
Eggnog | Serine protease(COG0265) |
Kegg | Link to kegg annotations (AT2G47940) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019441797.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer