Transcript | Ll_transcript_498765 |
---|---|
CDS coordinates | 1-717 (+) |
Peptide sequence | RKTRKKNQNQTQHSSLENKIIFIGVRSMADVVLVVDDLKYIGRIFRCRICHEEEEFENSTSMEAPCSCSGTIKFAHRDCIQRWCNEKGNTICEICLQEYEPGYTAPVKKYEENDEAMSIGEEEELNTRIEEMEEGVTLESECTFDADTNPSHFRLLALTIIIILLLRHFLAVCTNGTDDYPFTMFTVVILKASGIIIPMYFIIRIVGAIQNSIQHYHQVYNYHTSIADGDEENHLSYD* |
ORF Type | 5prime_partial |
Blastp | E3 ubiquitin-protein ligase MARCH2 from Danio with 37.74% of identity |
---|---|
Blastx | Probable E3 ubiquitin ligase SUD1 from Arabidopsis with 42.86% of identity |
Eggnog | (Membrane-Associated Ring finger (C3HC4))(COG5183) |
Kegg | Link to kegg annotations (555611) |
CantataDB | Link to cantataDB annotations (CNT0000623) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019440677.1) |
Pfam | RING-variant domain (PF12906.6) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer