Protein coding transcript 85491

• Transcript: Ll_transcript_498775
• CDS coordinates: 1-405 (+)
• Peptide sequence: RKTRKKNQNQTQHSSLENKIIFIGVRSMADVVLVVDDLKYIGRIFRCRICHEEEEFENSTSMEAPCSCSGTIKFAHRDCIQRWCNEKGNTICEICLQEYEPGYTAPVKKYEENDEAMSIGEEEELNTRIGEIREK
• ORF Type: internal

Annotations of Ll_transcript_498775

• Blastp: E3 ubiquitin-protein ligase MARCH2 from Danio with 37.74% of identity
• Blastx: Probable E3 ubiquitin ligase SUD1 from Arabidopsis with 42.86% of identity
• Eggnog: (Membrane-Associated Ring finger (C3HC4))(COG5183)
• Kegg: Link to kegg annotations (555611)
• CantataDB: Link to cantataDB annotations (CNT0000623)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440677.1)
• Pfam: RING-variant domain (PF12906.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;