Transcript | Ll_transcript_498534 |
---|---|
CDS coordinates | 175-612 (+) |
Peptide sequence | MGKDGKSGAKGKGKAGGSDENASKGKGKGAKGGDGLGTCTYVKARHILCEKQGKINEAYKKLQDGWLSNGDKVPPAEFAKVAQEYSECPSGKKGGDLGWFPRGKMAGPFQEVAFNTPVGVTSAPFKSTYLSCALSLLFPPFQFSH* |
ORF Type | complete |
Blastp | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 from Bos with 45.71% of identity |
---|---|
Blastx | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 from Bos with 50.6% of identity |
Eggnog | peptidyl-prolyl cis-trans isomerase(COG0760) |
Kegg | Link to kegg annotations (100126055) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_004500009.1) |
Pfam | PPIC-type PPIASE domain (PF13616.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer