| Transcript | Ll_transcript_497066 |
|---|---|
| CDS coordinates | 185-490 (+) |
| Peptide sequence | MLLNQGSTLVALMLLLCLLVDSTLIRSDIHVLLGSFVWSLSKVLWCCGTTVGCHVIFSFSLGLTSSSLVNSALLGWLGFFCNGWFYMLWRQMGCGLIFLPL* |
| ORF Type | complete |
| Blastp | - |
|---|---|
| Blastx | Importin subunit alpha-2 from Arabidopsis with 77.91% of identity |
| Eggnog | importin subunit alpha(COG5064) |
| Kegg | Link to kegg annotations (AT4G16143) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019441189.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer