Transcript | Ll_transcript_425524 |
---|---|
CDS coordinates | 448-1191 (+) |
Peptide sequence | MITKDPNPGLEGHVFANPVDAEGYMTMLVYKNGSLTREDARNRYAEKSWDVFNKFLQQTPPLNGGKLGFYYKEHEILPPLPVGYHRYVIENFSGDSLDGLKEQEEEFDPPSEVRALVEGQFLSMRAHAERFGMPSPPKRIIATGGASANESILSSIASVFGCDVYTVQRPDSASLGAALRAAHGWLCKKKGGFLPISDMYMDKLEKTSLSCKLSANAGDEELVSKYATFMKKRIEIENSLVQKLGRC* |
ORF Type | complete |
Blastp | Xylulose kinase from Bos with 45.6% of identity |
---|---|
Blastx | Xylulose kinase from Bos with 46.86% of identity |
Eggnog | Carbohydrate kinase(COG1070) |
Kegg | Link to kegg annotations (515146) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019415605.1) |
Pfam | FGGY family of carbohydrate kinases, C-terminal domain (PF02782.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer