| Transcript | Ll_transcript_496667 |
|---|---|
| CDS coordinates | 149-478 (+) |
| Peptide sequence | MFNPFQRYLMMLAKAEAGKKSSEGSDNHKKLLKDVETISKVLYPDENSYKNSASTAISQSKSTKIFPLPDPKSKPKASVDDKSVKDKKSIWNWKRLKALSINHSRKFNCC |
| ORF Type | 3prime_partial |
| Blastp | Protein PLASTID MOVEMENT IMPAIRED 1-RELATED 1 from Arabidopsis with 35.87% of identity |
|---|---|
| Blastx | - |
| Eggnog | NA(ENOG410Y9MA) |
| Kegg | Link to kegg annotations (AT5G20610) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019463634.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer