Protein coding transcript 8561

• Transcript: Ll_transcript_425527
• CDS coordinates: 674-1048 (+)
• Peptide sequence: MRAHAERFGMPSPPKRIIATGGASANESILSSIASVFGCDVYTVQRPDSASLGAALRAAHGWLCKKKGGFLPISDMYMDKLEKTSLSCKLSANAGDEELVSKYATFMKKRIEIENSLVQKLGRC*
• ORF Type: complete

Annotations of Ll_transcript_425527

• Blastp: Xylulose kinase from Rattus with 35.25% of identity
• Blastx: Xylulose kinase from Bos with 39.2% of identity
• Eggnog: Carbohydrate kinase(COG1070)
• Kegg: Link to kegg annotations (316067)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415605.1)
• Pfam: FGGY family of carbohydrate kinases, C-terminal domain (PF02782.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;