Protein coding transcript 85663

• Transcript: Ll_transcript_498409
• CDS coordinates: 242-967 (+)
• Peptide sequence: MATTTSPSLLFLLFFARVSGLAVTLLVLFWALSFNSSFLPSSLSQQDLIYSVLHPLLMVIGFIIVSGEAILVHRCLPGSTGLKKLVHLCLQGVALASGIFGIWTKFQGKDGILANFYSLHSWMGLICISLFGAQWLIGFLNFWHRGEVRKARIRILPWHVFLGLYTYALAIATAETGLLEKLTFIQTNRNVSKHSTESIVVNSLGLGLALLSGFVILAAVSPKYQTLQTKVLYSETRCLSS*
• ORF Type: complete

Annotations of Ll_transcript_498409

• Blastp: Probable transmembrane ascorbate ferrireductase 4 from Arabidopsis with 63.79% of identity
• Blastx: Probable transmembrane ascorbate ferrireductase 4 from Arabidopsis with 62.55% of identity
• Eggnog: Cytochrome(ENOG4111FKI)
• Kegg: Link to kegg annotations (AT1G26100)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454620.1)
• Pfam: Eukaryotic cytochrome b561 (PF03188.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;