Protein coding transcript 85697

• Transcript: Ll_transcript_498139
• CDS coordinates: 1-1092 (+)
• Peptide sequence: EKSCIDIESNNLNNKKPKRGDDHIHVGDCVLNDVGCRALIGGVCTHKKQIDPNDASIGDTTKIGVVRSEAPGVALDMSSLLLSIGIEKPLTDSVNDKLWHYQDPAGRVQGPFSMLQLYKWNASGHFPSDLRIWRIDEKQDYSILLTDALDGKCSKSVLLPHNSQLLSLGPNVTFDNKDNSQGNATRMEIDADSEDVKQSGEQKVDDTCTQSNGKDESVRSNGWNSYSSTPTEGINNEGQSGNFERREESSKYEISCHNQPHVYPSLPSNAFFENLNENPLDKLREGHGIEAIPEDNGNHDLNGTSGGQSNSGQSYQKQSDSEENSGQSSGQNWKGPQPINPVCNASTWLTIFGEPTACDESVSD
• ORF Type: internal

Annotations of Ll_transcript_498139

• Blastp: Zinc finger CCCH domain-containing protein 44 from Arabidopsis with 59.42% of identity
• Blastx: Zinc finger CCCH domain-containing protein 44 from Arabidopsis with 53.75% of identity
• Eggnog: GYF domain-containing protein(ENOG41120EC)
• Kegg: Link to kegg annotations (AT3G51120)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421712.1)
• Pfam: GYF domain (PF02213.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;