Transcript | Ll_transcript_497875 |
---|---|
CDS coordinates | 275-784 (+) |
Peptide sequence | MATPYPIPVTSAQVGTYFVGQYYHVLQTQPEFVHQFYSDASTMLRIDGHTRETAAAMLQIHAMVMSLSYTGIEIMTAQSMESWSGGVLVMVSGSVEIKEYSRRRKFMQTFFLAPQEKGFFVLNDIFHFVEEDPVNHHQAALLAQSNLDPKMNAPSAINNPGKFCFSMNL* |
ORF Type | complete |
Blastp | Putative G3BP-like protein from Schizosaccharomyces with 36.59% of identity |
---|---|
Blastx | Putative G3BP-like protein from Schizosaccharomyces with 32.79% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (SPBP8B7.11) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019449982.1) |
Pfam | Nuclear transport factor 2 (NTF2) domain (PF02136.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer