Protein coding transcript 85760

• Transcript: Ll_transcript_497875
• CDS coordinates: 275-784 (+)
• Peptide sequence: MATPYPIPVTSAQVGTYFVGQYYHVLQTQPEFVHQFYSDASTMLRIDGHTRETAAAMLQIHAMVMSLSYTGIEIMTAQSMESWSGGVLVMVSGSVEIKEYSRRRKFMQTFFLAPQEKGFFVLNDIFHFVEEDPVNHHQAALLAQSNLDPKMNAPSAINNPGKFCFSMNL*
• ORF Type: complete

Annotations of Ll_transcript_497875

• Blastp: Putative G3BP-like protein from Schizosaccharomyces with 36.59% of identity
• Blastx: Putative G3BP-like protein from Schizosaccharomyces with 32.79% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPBP8B7.11)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449982.1)
• Pfam: Nuclear transport factor 2 (NTF2) domain (PF02136.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;