Protein coding transcript 85793

• Transcript: Ll_transcript_497039
• CDS coordinates: 144-488 (+)
• Peptide sequence: MSTPARKRLMRDFKRLQQDPPAGISGAPQDNNIMLWNAVIFGPDDTPWDGGTFKLTLQFSEDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCD
• ORF Type: 3prime_partial

Annotations of Ll_transcript_497039

• Blastp: Ubiquitin-conjugating enzyme E2 2 from Arabidopsis with 99.13% of identity
• Blastx: Ubiquitin-conjugating enzyme E2 1 from Arabidopsis with 99.13% of identity
• Eggnog: ubiquitin-conjugating enzyme(COG5078)
• Kegg: Link to kegg annotations (AT2G02760)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017409129.1)
• Pfam: Ubiquitin-conjugating enzyme (PF00179.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;