Protein coding transcript 859

• Transcript: Ll_transcript_435624
• CDS coordinates: 151-471 (+)
• Peptide sequence: MSCSNWRKKLETGLKRVIKTKEKLITDEIVALQKKGIKLEDESRKLKQKMSMMYKGKSPLMVDKDIAIQEVVSLDSMNNVCSCNSCPSLDDDSSDISLKLGLSYPD*
• ORF Type: complete

Annotations of Ll_transcript_435624

• Blastp: MADS-box protein SVP from Arabidopsis with 36.94% of identity
• Blastx: MADS-box protein SVP from Arabidopsis with 57.45% of identity
• Eggnog: Transcription factor(COG5068)
• Kegg: Link to kegg annotations (AT2G22540)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460721.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;