Protein coding transcript 85905

• Transcript: Ll_transcript_497931
• CDS coordinates: 163-462 (+)
• Peptide sequence: MYLFHFLVQGGLTATDVFAVEWIQTNKVHFGLTVSYYGFVSDGKSMLCLKFLNSDFISLLNAVHLLLLKKGKALGLYLMGSLLLLEQLYFNTFCRTCWS*
• ORF Type: complete

Annotations of Ll_transcript_497931

• Blastp: Sphingoid long-chain bases kinase 1 from Arabidopsis with 80.56% of identity
• Blastx: Sphingoid long-chain bases kinase 1 from Arabidopsis with 80.56% of identity
• Eggnog: diacylglycerol kinase(COG1597)
• Kegg: Link to kegg annotations (AT5G23450)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452866.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;