Protein coding transcript 85931

• Transcript: Ll_transcript_497672
• CDS coordinates: 822-1601 (+)
• Peptide sequence: MKINTCNGMKCGETFTGPNSPNKPTMWTENWTSFYQVYGGIPYIRSAQDIAFHVTLFIARNGSYVNYYMYHGGTNFGRTASAYVITGYYDQAPLDEYGLFRQPKWGHLKELHAAIKSCSTTLLQGVPRNFSLGQLQEGYVFEEENGGCVAFLINNDVVNNVTVQFHNRSYELLPKSISVLPDCQNVTFNTANVNTTSNRRIYIPRQNFSSVNDWEQFEDVIPNFDDTSLRSNSLLEHMNTTKDKSDYLWYTVRLVISYF*
• ORF Type: complete

Annotations of Ll_transcript_497672

• Blastp: Beta-galactosidase 6 from Arabidopsis with 66.27% of identity
• Blastx: Beta-galactosidase 6 from Arabidopsis with 66.27% of identity
• Eggnog: beta-galactosidase(COG1874)
• Kegg: Link to kegg annotations (AT5G63800)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417221.1)
• Pfam: Glycosyl hydrolases family 35 (PF01301.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;