Protein coding transcript 85960

• Transcript: Ll_transcript_498179
• CDS coordinates: 235-867 (+)
• Peptide sequence: MVYENNNWIWEGIYYYPNVFGVLMVTAALLGLSTSFFGGIGVHLPLPYSWSNLRIFDKKKSGKRRVRVYMDGCFDLMHYGHANALRQAKALGDELVVGLVSDEEILANKGPPVLSMEERLTLVSGLKWVDEVITEAPYAITEEFLNRLFHEYKIDYVIHGDDPCLLPDGTDAYAAAKKAGRYKQIKRTEGVSSTDIVGRIMSSLRDPKKL*
• ORF Type: complete

Annotations of Ll_transcript_498179

• Blastp: Ethanolamine-phosphate cytidylyltransferase from Arabidopsis with 73.86% of identity
• Blastx: Ethanolamine-phosphate cytidylyltransferase from Arabidopsis with 73.86% of identity
• Eggnog: cytidylyltransferase(COG0615)
• Kegg: Link to kegg annotations (AT2G38670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446442.1)
• Pfam: Cytidylyltransferase-like (PF01467.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;