Transcript | Ll_transcript_498189 |
---|---|
CDS coordinates | 285-917 (+) |
Peptide sequence | MVYENNNWIWEGIYYYPNVFGVLMVTAALLGLSTSFFGGIGVHLPLPYSWSNLRIFDKKKSGKRRVRVYMDGCFDLMHYGHANALRQAKALGDELVVGLVSDEEILANKGPPVLSMEERLTLVSGLKWVDEVITEAPYAITEEFLNRLFHEYKIDYVIHGDDPCLLPDGTDAYAAAKKAGRYKQIKRTEGVSSTDIVGRIMSSLRDPKKL* |
ORF Type | complete |
Blastp | Ethanolamine-phosphate cytidylyltransferase from Arabidopsis with 73.86% of identity |
---|---|
Blastx | Ethanolamine-phosphate cytidylyltransferase from Arabidopsis with 66.99% of identity |
Eggnog | cytidylyltransferase(COG0615) |
Kegg | Link to kegg annotations (AT2G38670) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019446442.1) |
Pfam | Cytidylyltransferase-like (PF01467.25) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer