Transcript | Ll_transcript_498974 |
---|---|
CDS coordinates | 1-540 (+) |
Peptide sequence | LCLILLICFYFNCFVCAGTRFRPLSFNTPKPLFPLAGQPMVHHPISACKKIPNLAQIYLVGFYEEREFALYVSSISYELKLPVRYLKEDKPHGSAGGLYYFRDIIMEDNPSHIFLLNCDVCCSFPLSSMLEAHRRYGGMGTMLVIKVSNLINCGVYIFTPEIFNAIEDVSMNREGRANLR |
ORF Type | internal |
Blastp | Mannose-1-phosphate guanyltransferase alpha from Dictyostelium with 42.22% of identity |
---|---|
Blastx | Mannose-1-phosphate guanyltransferase alpha from Dictyostelium with 42.22% of identity |
Eggnog | nucleotidyl transferase(COG1208) |
Kegg | Link to kegg annotations (DDB_G0271858) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019452921.1) |
Pfam | Nucleotidyl transferase (PF00483.22) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer