Protein coding transcript 86058

• Transcript: Ll_transcript_498982
• CDS coordinates: 960-1676 (+)
• Peptide sequence: MQVSNLINCGVYIFTPEIFNAIEDVSMNREGRANLRRVSSFEALQSATRTLPSDFVRLDQDILSPLAGKKQLYTYETMDFWEQIKTPGMSLKCSELYLAQFRYTSSHLLASGDGKRNPTVVGDVYIHPSAKVHPSAKIGPNVSISANVRVGPGVRLIHCIILDDVEIKENALVINSIVGWKSSIGRWSRVQADGDYNAKLGTTILGEDVIVEDEVVVINSIVLPHKTLNVSVQEEIIL*
• ORF Type: complete

Annotations of Ll_transcript_498982

• Blastp: Mannose-1-phosphate guanyltransferase alpha-B from Danio with 42.75% of identity
• Blastx: Mannose-1-phosphate guanyltransferase alpha from Dictyostelium with 43.06% of identity
• Eggnog: nucleotidyl transferase(COG1208)
• Kegg: Link to kegg annotations (393469)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452921.1)
• Pfam: Bacterial transferase hexapeptide (six repeats) (PF00132.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;