Transcript | Ll_transcript_498982 |
---|---|
CDS coordinates | 960-1676 (+) |
Peptide sequence | MQVSNLINCGVYIFTPEIFNAIEDVSMNREGRANLRRVSSFEALQSATRTLPSDFVRLDQDILSPLAGKKQLYTYETMDFWEQIKTPGMSLKCSELYLAQFRYTSSHLLASGDGKRNPTVVGDVYIHPSAKVHPSAKIGPNVSISANVRVGPGVRLIHCIILDDVEIKENALVINSIVGWKSSIGRWSRVQADGDYNAKLGTTILGEDVIVEDEVVVINSIVLPHKTLNVSVQEEIIL* |
ORF Type | complete |
Blastp | Mannose-1-phosphate guanyltransferase alpha-B from Danio with 42.75% of identity |
---|---|
Blastx | Mannose-1-phosphate guanyltransferase alpha from Dictyostelium with 43.06% of identity |
Eggnog | nucleotidyl transferase(COG1208) |
Kegg | Link to kegg annotations (393469) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019452921.1) |
Pfam | Bacterial transferase hexapeptide (six repeats) (PF00132.23) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer